PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 429aa    MW: 47205.1 Da    PI: 8.4758
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019376genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.92.4e-09213271563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK  +i+eLe+kv++L++  ++L  +l  l+     l++e+
  Lus10019376 213 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTDATSLSAQLTLLQRDTNGLTAEN 271
                  9********************************************99998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-15209273IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657211274IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.18E-10213264No hitNo description
PfamPF001703.3E-8213267IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-9213267No hitNo description
CDDcd147036.97E-25214263No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MAGYRRRFFS PPVFIGGRFP SFSPQGNSYS VKPELPSSPT FPPLTSSDSG RFSHDISRMS  60
DNPPKNMGHR RAHSEILTLP DDISFDSDLG VVGADGPSFS DDTEEDILSV YLNMEKLNSS  120
SATSGFQIGE SSNHFLSPAD NNWTGSSAPM MLDGASAPTE RPRVRHQHSQ SMDGSSSIKS  180
EMLMSASEDA SGVDYKKAIS AAKLAELALV DPKRAKRIWA NRQSAARSKE RKMRYIAELE  240
RKVQTLQTDA TSLSAQLTLL QRDTNGLTAE NSELKLRLQT TEQQVHLQDA ASGKKIHRKF  300
AMEFIHLHPR PILLEMLLHG LSSDLSRAGC VSQTNLNFLL IAHXYLSPPC PSVVQLQLAT  360
LGLHLRRICF ENSSSFLLGT PQNCPGISAF KDWTRIVGPP TASFNKYYGW CLKMAVDDQR  420
QRLLADGG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065205.11e-141PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-114POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A067LI271e-141A0A067LI27_JATCU; Uncharacterized protein
STRINGVIT_05s0102g01120.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55173249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-126bZIP family protein